Overview

  • Product name
    Recombinant Human ODF4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDAEYSGNEFPRSEGERDQHQRPGKERKSGEAGWGTGELGQDGRLLSSTL SLSSNRSLGQRQNSPLPFQWRITHSFRWMAQVLASELSLVAFILLLVVAF SKKWLDLSRSLFYQRWPVDVSNRIHTSAHVMSMGLLHFYKSRSCSDLENG KVTFIFSTLMLFPINIWIFELERNVSIPIGWSYFIGWLVLILYFTCAILC YFNHKSFWSLILSHPSGAVSCSSSFGSVEESPRAQTITDTPITQEGVLDP EQKDTHV
    • Amino acids
      1 to 257
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165541 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hOPPO1
    • MGC138215
    • MGC138219
    • OPPO1
    • Outer dense fiber of sperm tails protein 4
    • Outer dense fiber protein 4
    • Testis specific protein oppo 1
    see all
  • Relevance
    Component of the outer dense fibers (ODF) of spermatozoa which could be involved in sperm tail structure, sperm movement and general organization of cellular cytoskeleton
  • Cellular localization
    Cell Membrane

Images

  • ab165541 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165541 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165541.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up