Overview

  • Product name
    Recombinant Human OFD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLNEKVKEMSDYSLLKEEKLELLAQNKLLKQQLEESRNENLRLLNRLAQP APELAVFQKELRKAEKAIVVEHEEFESCRQALHKQLQDEIEHSAQLKAQI LGYKASVKSLTTQVADLKLQLKQTQTALENEVYCNPKQSVIDRSVNGLIN GNVVPCNGEISGDFLNNPFKQENVLARMVASRITNYPTAWVEGSSPDSDL EFVANTKARVKELQQEAERLEKAFRSYHRRVIKNSAKSPLAAKSPPSLHL LEAFKNITSSSPERHIFGEDRVVSEQPQVGTLEERNDVVEALTGSAASRL RGGTSSRRLSSTPLPKAKRSLESEMYLEGLGRSHIASPSPCPDRMPLPSP TESRHSLSIPPVSSPPEQKVGLYRRQTELQDKSEFSDVDKLAFKDNEEFE SSFECVDQKQIEEQKEEEKIREQQVKERRQREERRQSNLQEVLERERREL EKLYQERKMIEESLKIKIKKELEMENELEMSNQEIKDKSAHSENPLEKYM KIIQQEQDQESADKSSKKMVQEGSLVDTLQSSDKVESLTGFSHEELDDSW
    • Amino acids
      1 to 550
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160047 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 71 7A
    • 717A
    • CXorf5
    • JBTS10
    • Ofd1
    • OFD1_HUMAN
    • oral facial digital syndrome 1
    • Oral-facial-digital syndrome 1 protein
    • OTTHUMP00000022941
    • Protein 71-7A
    • RGD1562231
    • SGBS2
    see all
  • Function
    Component of the centrioles controlling mother and daughter centrioles length. Recruits to the centriole IFT88 and centriole distal appendage-specific proteins including CEP164. Involved in the biogenesis of the cilium, a centriole-associated function. The cilium is a cell surface projection found in many vertebrate cells required to transduce signals important for development and tissue homeostasis. Plays an important role in development by regulating Wnt signaling and the specification of the left-right axis. Only OFD1 localized at the centriolar satellites is removed by autophagy, which is an important step in the ciliogenesis regulation.
  • Tissue specificity
    Widely expressed. Expressed in 9 and 14 weeks old embryos in metanephric mesenchyme, oral mucosa, lung, heart, nasal and cranial cartilage, and brain. Expressed in metanephros, brain, tongue, and limb.
  • Involvement in disease
    Orofaciodigital syndrome 1
    Simpson-Golabi-Behmel syndrome 2
    Joubert syndrome 10
    Retinitis pigmentosa 23
  • Sequence similarities
    Belongs to the OFD1 family.
    Contains 1 LisH domain.
  • Cellular localization
    Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriole. Cytoplasm, cytoskeleton, cilium basal body. Nucleus. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome, centriolar satellite. Localizes to centriole distal ends and to centriolar satellites (PubMed:20230748, PubMed:24121310).
  • Information by UniProt

Images

  • ab160047 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160047 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160047.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up