Overview

  • Product nameRecombinant Human Ogg1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO15527
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHTGSMPARALLPRRMGHRTLASTPALWASIP CPRSELRLDLVLPSGQSFRWREQSPAHWSGVLADQVWTLTQTEEQLHCTV YRGDKSQASRPTPDELEAVRKYFQLDVTLAQLYHHWGSVDSHFQEVAQKF QGVRLLRQDPIECLFSFICSSNNNIARITGMVERLCQAFGPRLIQLDDVT YHGFPSLQALAGPEVEAHLRKLGLGYRARYVSASARAILEEQGGLAWLQQ LRESSYEEAHKALCILPGVGTKVADCICLMALDKPQAVPVDVHMWHIAQR DYSWHPTTSQAKGPSPQTNKELGNFFRSLWGPYAGWAQAVLFSADLRQCR HAQEPPAKRRKGSKGPEG
    • Molecular weight41 kDa including tags
    • Amino acids1 to 345
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98249 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab98249 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 40% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • 8 hydroxyguanine DNA glycosylase
    • 8 oxoguanine DNA glycosylase
    • 8 oxoguanine DNA glycosylase 1
    • AP lyase
    • DNA (apurinic or apyrimidinic site) lyase
    • DNA apurinic or apyrimidinic site lyase
    • DNA lyase
    • DNA-(apurinic or apyrimidinic site) lyase
    • HMMH
    • HOGG 1
    • HOGG1
    • MMH
    • MUTM
    • N glycosylase
    • Ogg 1
    • Ogg1
    • OGG1_HUMAN
    • OGH 1
    • OGH1
    see all
  • FunctionDNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta-lyase activity that nicks DNA 3' to the lesion.
  • Tissue specificityUbiquitous.
  • Involvement in diseaseDefects in OGG1 may be a cause of renal cell carcinoma (RCC) [MIM:144700]. It is a heterogeneous group of sporadic or hereditary carcinoma derived from cells of the proximal renal tubular epithelium. It is subclassified into clear cell renal carcinoma (non-papillary carcinoma), papillary renal cell carcinoma, chromophobe renal cell carcinoma, collecting duct carcinoma with medullary carcinoma of the kidney, and unclassified renal cell carcinoma.
  • Sequence similaritiesBelongs to the type-1 OGG1 family.
  • Cellular localizationMitochondrion; Nucleus and Nucleus > nucleoplasm. Nucleus speckle. Nucleus matrix. Together with APEX1 is recruited to nuclear speckles in UVA-irradiated cells.
  • Information by UniProt

Recombinant Human Ogg1 protein images

  • 15% SDS-PAGE analysis of 3µg ab98249

References for Recombinant Human Ogg1 protein (ab98249)

ab98249 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98249.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"