Recombinant Human OGT / O-Linked N-Acetylglucosamine Transferase protein (ab91749)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceSQIPCNGKAADRIHQDGIHILVNMNGYTKGARNELFALRPAPIQAMWL GYPGTSGALFMDYIITDQETSPAEVAEQYSEKLAYMPHTFFIGDHANM FPHLKKKAVIDFKSNGHIYDNRIVLNGIDLKAFLDSLPDVKIVKMKCP DGGDNADSSNTALNMPVIPMNTIAEAVIEMINRGQIQITINGFSISNG LATTQINNKAATGEEVPRTIIVTTRSQYGLPEDAIVYCNFNQLYKIDP STLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLPQNRIIFS PVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETL ASRVAASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWK QRISSPLFNTKQYTMELERLYLQMWEHYAAGNK
    • Amino acids606 to 1022

Specifications

Our Abpromise guarantee covers the use of ab91749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 81 µl aqua dest.

General Info

  • Alternative names
    • FLJ23071
    • GlcNAc transferase
    • HRNT1
    • MGC22921
    • O GlcNAc
    • O GlcNAc transferase p110 subunit
    • O GlcNAc transferase subunit p110
    • O linked N acetylglucosamine (GlcNAc) transferase
    • O linked N acetylglucosamine (GlcNAc) transferase (UDP N acetylglucosamine:polypeptide N acetylglucosaminyl transferase)
    • O linked N acetylglucosamine transferase 110 kDa subunit
    • O-GlcNAc transferase subunit p110
    • O-linked N-acetylglucosamine transferase 110 kDa subunit
    • ogt
    • OGT1_HUMAN
    • UDP N acetylglucosamine peptide N acetylglucosaminyltransferase 110 kDa subunit
    • UDP N acetylglucosamine peptide N acetylglucosaminyltransferase GlcNAc transferase
    • UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit
    • UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase
    • Uridinediphospho N acetylglucosamine:polypeptide beta N acetylglucosaminyl transferase
    see all
  • FunctionAddition of nucleotide-activated sugars directly onto the polypeptide through O-glycosidic linkage with the hydroxyl of serine or threonine. Mediates the O-glycosylation of MLL5 and HCFC1. Promotes proteolytic maturation of HCFC1.
  • Tissue specificityHighly expressed in pancreas and to a lesser extent in skeletal muscle, heart, brain and placenta. Present in trace amounts in lung and liver.
  • PathwayProtein modification; protein glycosylation.
  • Sequence similaritiesBelongs to the O-GlcNAc transferase family.
    Contains 13 TPR repeats.
  • DomainThe TPR repeat domain mediates recognition of protein substrates.
  • Post-translational
    modifications
    Ubiquitinated, leading to its proteasomal degradation.
  • Cellular localizationCytoplasm. Nucleus. Mostly in the nucleus.
  • Information by UniProt

Recombinant Human OGT / O-Linked N-Acetylglucosamine Transferase protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human OGT / O-Linked N-Acetylglucosamine Transferase protein (ab91749)

ab91749 has not yet been referenced specifically in any publications.

Product Wall

Thank you very much for your interest in ab91749.

To our knowledge, ab91749 has not been tested in any functional assays. Therefore, I can offer a discount off a future purchase if you buy ab91749 now, test it in any functional assays and su...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"