Overview

  • Product name
    Recombinant Human OIF protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KSRGIKANAFKKLNNLTFLYLDHNALESVPLNLPESLRVIHLQFNNIASI TDDTFCKANDTSYIRDRIEEIRLEGNPIVLGKHPNSFICLKRLPIGSYF
    • Amino acids
      200 to 298
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159025 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Corneal keratan sulfate proteoglycan
    • DKFZP586P2421
    • MIME_HUMAN
    • Mimecan
    • Mimecan proteoglycan
    • OG
    • OGN
    • OIF
    • Osteoglycin
    • Osteoinductive factor
    • SLRR3A
    see all
  • Function
    Induces bone formation in conjunction with TGF-beta-1 or TGF-beta-2.
  • Tissue specificity
    Bone.
  • Sequence similarities
    Belongs to the small leucine-rich proteoglycan (SLRP) family. SLRP class III subfamily.
    Contains 7 LRR (leucine-rich) repeats.
  • Post-translational
    modifications
    N- and O-glycosylated. O-glycosylated with a core 1 or possibly core 8 glycan.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

Images

  • ab159025 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159025 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159025.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up