Overview

  • Product name
    Recombinant Human OIP5 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAQPLRHRSRCATPPRGDFCGGTERAIDQASFTTSMEWDTQVVKGSSPL GPAGLGAEEPAAGPQLPSWLQPERCAVFQCAQCHAVLADSVHLAWDLSRS LGAVVFSRVTNNVVLEAPFLVGIEGSLKGSTYNLLFCGSCGIPVGFHLYS THAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELK EKIVLTHNRLKSLMKILSEVTPDQSKPEN
    • Amino acids
      1 to 229
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5730547N13Rik
    • Cancer/testis antigen 86
    • CT 86
    • CT86
    • hMIS18beta
    • LAP2alpha interactor 25
    • LINT 25
    • LINT25
    • MIS18B
    • MIS18beta
    • MS18B_HUMAN
    • OIP 5
    • OIP-5
    • OIP5
    • Opa interacting protein 5
    • Opa-interacting protein 5
    • Protein Mis18-beta
    see all
  • Function
    Required for recruitment of CENPA to centromeres and normal chromosome segregation during mitosis.
  • Cellular localization
    Nucleus. Chromosome. Chromosome > centromere. Associated with centromeres in interphase cells, from late anaphase to the G1 phase. Not detected on centromeres during earlier phases of mitosis. Associated with chromatin.
  • Information by UniProt

Images

  • ab161418 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up