Recombinant Human Olfactory Marker Protein (ab114419)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP47874
    • SpeciesHuman
    • SequenceFERWNVVLDKPGKVTITGTSQNWTPDLTNLMTRQLLDPTAIFWRKEDSDA IDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKASVVFNQL
    • Molecular weight37 kDa including tags
    • Amino acids65 to 163

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114419 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Olfactory marker protein
    • Olfactory neuronal specific protein
    • OMP
  • RelevanceOlfactory marker protein (OMP) is an abundant, 19kDa, cytosolic protein that is almost exclusively expressed in mature, functioning, olfactory neurons but not in the neural precursor basal cells. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human. Its tissue specific expression in the receptor cells together with the results of the mouse knockout studies show that OMP represents a novel modulatory component of the odor detection/signal transduction cascade.
  • Cellular localizationCytoplasmic

Recombinant Human Olfactory Marker Protein images

  • ab114419 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Olfactory Marker Protein (ab114419)

ab114419 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114419.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"