Recombinant Human OLFML2A protein (ab165811)

Overview

  • Product name
    Recombinant Human OLFML2A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSKRDKAGKDTARGKGKDISKYGSVQKSFADRGLPKPPKEKLLQVEKLRK ESGKGSFLQPTAKPRALAQQQAVIRGFTYYKAGKQEVTEAVADNALQGTS WLEQLPPKVEGRSNSAEPNSAEQDEAEPRSSERVDLASGTPTSIPATTTT ATTTPTPTTSLLPTEPPSGPEVSSQGREASCEGTLRAVDPPVRHHSYGRH EGAWMKDPAARDDRIYVTNYYYGNSLVEFRNLENFKQGRWSNMYKLPYNW IGTGHVVYQGAFYYNRAFTKNIIKYDLRQRFVASWALLPDVVYEDTTPWK WRGHSDIDFAVDESGLWVIYPAVDDRDEAQPEVIVLSRLDPGDLSVHRET TWKTRLRRNSYGNCFLVCGILYAVDTYNQQEGQVAYAFDTHTGTDARPQL PFLNEHAYTTQIDYNPKERVLYAWDNGHQLTYTLHFVV
    • Amino acids
      1 to 438
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ00237
    • Olfactomedin like 2A
    • Olfactomedin like protein 2A
    • OLM2A_HUMAN
    • Photomedin 1
    • PRO34319
    • UNQ9394/PRO34319
    see all
  • Relevance
    OLFML2A contains one olfactomedin-like domain. Its exact function is unknown. There are three named isoforms produced by alternative splicing.
  • Cellular localization
    Secreted

Images

  • ab165811 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up