Overview

  • Product name
    Recombinant Human Olig1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRPQRPGDLQLGASLYELVGYRQPPSSSSSSTSSTSSTSSSSTTAPLLP KAAREKPEAPAEPPGPGPGSGAHPGGSARPDAKEEQQQQLRRKINSRERK RMQDLNLAMDALREVILPYSAAHCQGAPGRKLSKIATLLLARNYILLLGS SLQELRRALGEGAGPAAPRLLLAGLPLLAAAPGSVLLAPGAVGPPDALRP AKYLSLALDEPPCGQFALPGGGAGGPGLCTCAVCKFPHLVPASLGLAAVQ AQFSK
    • Amino acids
      1 to 255
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic domain helix loop helix protein class B 6
    • Basic domain helix loop helix protein class B6
    • BHLH B6
    • BHLHB 6
    • bHLHb6
    • bHLHe21
    • Class B basic helix-loop-helix protein 6
    • Class E basic helix-loop-helix protein 21
    • Olig 1
    • Olig1
    • OLIG1_HUMAN
    • Oligo 1
    • Oligo1
    • Oligodendrocyte lineage transcription factor 1
    • Oligodendrocyte specific bHLH transcription factor 1
    • Oligodendrocyte transcription factor 1
    see all
  • Function
    Promotes formation and maturation of oligodendrocytes, especially within the brain. Cooperates with OLIG2 to establish the pMN domain of the embryonic neural tube.
  • Tissue specificity
    Expressed in the brain, in oligodendrocytes. Strongly expressed in oligodendrogliomas, while expression is weak to moderate in astrocytomas. Expression in glioblastomas is highly variable.
  • Sequence similarities
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153583 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up