Overview

  • Product name
    Recombinant Human Olig3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHQESRLNSVSSTQGDMMQK MPGESLSRAGAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLN LAMDGLREVMPYAHGPSVRKLSKIATLLLARNYILMLTSSLEEMKRLVGE IYGGHHSAFHCGTVGHSAGHPAHAANSVHPVHPILGGALSSGNASSPLSA ASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPCPCTICQMPPPP HLSALSTANMARLSAESKDLLK
    • Amino acids
      1 to 272
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165797 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Basic helix loop helix domain containing class B protein 7
    • Basic helix-loop-helix domain-containing protein, class B, 7
    • bHLHB7
    • bHLHe20
    • Class B basic helix loop helix protein 7
    • Class B basic helix-loop-helix protein 7
    • Class E basic helix loop helix protein 20
    • Class E basic helix-loop-helix protein 20
    • Olig3
    • OLIG3_HUMAN
    • Oligo3
    • Oligodendrocyte lineage transcription factor 3
    • Oligodendrocyte specific bHLH transcription factor 3
    • Oligodendrocyte transcription factor 3
    see all
  • Function
    May determine the distinct specification program of class A neurons in the dorsal part of the spinal cord and suppress specification of class B neurons.
  • Sequence similarities
    Contains 1 bHLH (basic helix-loop-helix) domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab165797 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165797 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165797.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up