Recombinant Human oncomodulin protein (ab104164)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP0CE72
    • SpeciesHuman
    • SequenceMKHHHHHHASITDVLSADDIAAALQECRDPDTFEPQKFFQTSGLSKMSAN QVKDVFRFIDNDQSGYLDEEELKFFLQKFESGARELTESETKSLMAAADN DGDGKIGAEEFQEMVHS
    • Molecular weight13 kDa including tags
    • Amino acids2 to 109
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab104164 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • FormLyophilised
  • Additional notesProduct is not sterile! Please filter the product by an appropriate sterile filter before using it in the cell culture.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Preservative: None
    Constituents: 50mM Sodium chloride, 20mM Tris, pH 7.5

  • ReconstitutionAdd deionized water to prepare a working stock solution of approximately 0.5 mg/ml and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at -80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names
    • Ocm
    • OCMN
    • OM
    • onco
    • ONCO_HUMAN
    • Oncomodulin-1
    • Parvalbumin beta
    see all
  • FunctionHas some calmodulin-like activity with respect to enzyme activation and growth regulation. Binds two calcium ions.
  • Sequence similaritiesBelongs to the parvalbumin family.
    Contains 2 EF-hand domains.
  • Information by UniProt

Recombinant Human oncomodulin protein images

  • 14% SDS-PAGE:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: Reduced and boiled sample, 5µg/lane.
    Lane 3: Non-reduced and non-boiled sample, 5µg/lane

References for Recombinant Human oncomodulin protein (ab104164)

ab104164 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab104164.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"