Recombinant Human Oncostatin M protein (ab109963)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAIGSCSKEYRVLLGQLQKQTDLMQDTSR LLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLG CVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMA QLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHS VGRVFSKWGESPNRSRRHSPHQALRKGVRR
    • Molecular weight
      26 kDa including tags
    • Amino acids
      26 to 234
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab109963 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC20461
    • ONCM_HUMAN
    • Oncostatin M
    • Oncostatin-M
    • OSM
    see all
  • Function
    Growth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST).
  • Sequence similarities
    Belongs to the LIF/OSM family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109963.

References

ab109963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up