Recombinant Human Oncostatin M protein (ab109963)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP13725
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAIGSCSKEYRVLLGQLQKQTDLMQDTSR LLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLG CVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMA QLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHS VGRVFSKWGESPNRSRRHSPHQALRKGVRR
    • Molecular weight26 kDa including tags
    • Amino acids26 to 234
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab109963 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC20461
    • ONCM_HUMAN
    • Oncostatin M
    • Oncostatin-M
    • OSM
    see all
  • FunctionGrowth regulator. Inhibits the proliferation of a number of tumor cell lines. Stimulates proliferation of AIDS-KS cells. It regulates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Uses both type I OSM receptor (heterodimers composed of LIPR and IL6ST) and type II OSM receptor (heterodimers composed of OSMR and IL6ST).
  • Sequence similaritiesBelongs to the LIF/OSM family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Oncostatin M protein images

  • 15% SDS-PAGE analysis of 3µg ab109963.

References for Recombinant Human Oncostatin M protein (ab109963)

ab109963 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab109963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"