Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVVGAFPMAKLLYLGIRQVSKPLANRIKEAARRSEFFKTYICLPPAQLYH WVEMRTKMRIMGFRGTVIKPLNEEAAAELGAELLGEATIFIVGGGCLVLE YWRHQAQQRHKEEEQRAAWNALRDEVGHLALALEALQAQVQAAPPQGALE ELRTELQEVRAQLCNPGRSASHAVPASKK
    • Amino acids
      1 to 179
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164221 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ22187
    • FLJ25932
    • Iraqi Jewish optic atrophy plus (3 methylglutaconicaciduria type 3)
    • MGA3
    • MGC75494
    • OPA 3
    • OPA3 protein
    • Optic atrophy 3
    • Optic atrophy 3 (autosomal recessive, with chorea and spastic paraplegia)
    • Optic atrophy 3 (Iraqi Jewish 'optic atrophy plus')
    • Optic atrophy 3 protein
    see all
  • Relevance
    OPA3 may play some role in mitochondrial processes. Defects in OPA3 are the cause of 3-methylglutaconic aciduria type 3 (MGA3), also known as optic atrophy plus syndrome, and of optic atrophy type 3 (OPA3), also known as autosomal dominant optic atrophy and cataract (ADOAC).
  • Cellular localization
    Mitochondrial

Images

  • ab164221 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164221 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164221.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up