Overview

  • Product name
    Recombinant Human OR1I1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RNKDMKAALGKLIGKVAVPCPRPEQLLDVYHVPGSLLAARDTEMHPIPYP GGVQSLAGNRDME
    • Amino acids
      293 to 355
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165253 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Olfactory receptor 19 20
    • Olfactory receptor 1I1
    • Olfactory receptor family 1 subfamily I member 1
    • olfactory receptor, family 1, subfamily I, member 1
    • OR19 20
    • OR1I1
    • OR1I1P
    • OR1I1Q
    see all
  • Relevance
    OR1I1 is an olfactory receptor that interacts with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. Members of a large family of G protein coupled receptors 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals.
  • Cellular localization
    Cell membrane; Multipass membrane protein.

Images

  • ab165253 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165253 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165253.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up