Overview

  • Product name
    Recombinant Human OR2C3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEIANVSSPEVFVLLGFSARPSLETVLFIVVLSFYMVSILGNGIIILVSH TDVHLHTPMYFFLANLSFLDMSFTTSIVPQLLANLWGPQKTISYGGCVVQ FYISHWLGATECVLLATMSYDRYAAICRPLHYTVIMHPQLCLGLALASWL GGLTTSMVGSTLTMLLPLCGNNCIDHFFCEMPLIMQLACVDTSLNEMEMY LASFVFVVLPLGLILVSYGHIARAVLKIRSAEGRRKAFNTCSSHVAVVSL FYGSIIFMYLQPAKSTSHEQGKFIALFYTVVTPALNPLIYTLRNTEVKSA LRHMVLENCCGSAGKLAQI
    • Amino acids
      1 to 319
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Olfactory receptor 2C3
    • Olfactory receptor, family 2, subfamily C, member 3
    • OR2C4
    • OR2C5P
    • OST742
    see all
  • Relevance
    OR2C3 is an olfactory receptor. These receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G protein coupled receptors (GPCR) arising from single coding exon genes. Olfactory receptors share a 7 transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome
  • Cellular localization
    Cell membrane; Multi pass membrane protein.

Images

  • ab164325 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up