Overview

  • Product name
    Recombinant Human ORAV1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMAGSQDIFDAIVMADERFHGEGYREG YEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDS RKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDF KISAEGSGLSF
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 137
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab124571 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Oral cancer overexpressed 1
    • Oral cancer overexpressed protein 1 A
    • Oral cancer-overexpressed protein 1
    • ORAOV1
    • ORAOV1 oral cancer overexpressed 1
    • ORAV1_HUMAN
    • TAOS1
    • Tumor amplified and overexpressed sequence 1
    • Tumor-amplified and overexpressed sequence 1
    see all
  • Tissue specificity
    Widely expressed. Highly expressed in placenta, kidney and skeletal muscle.
  • Sequence similarities
    Belongs to the ORAOV1 family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab124571.

References

ab124571 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up