Overview

  • Product nameRecombinant Human ORAV1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ8WV07
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMAGSQDIFDAIVMADERFHGEGYREG YEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDS RKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDF KISAEGSGLSF
    • Molecular weight18 kDa including tags
    • Amino acids1 to 137
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124571 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab124571 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Oral cancer overexpressed 1
    • Oral cancer overexpressed protein 1 A
    • Oral cancer-overexpressed protein 1
    • ORAOV1
    • ORAOV1 oral cancer overexpressed 1
    • ORAV1_HUMAN
    • TAOS1
    • Tumor amplified and overexpressed sequence 1
    • Tumor-amplified and overexpressed sequence 1
    see all
  • Tissue specificityWidely expressed. Highly expressed in placenta, kidney and skeletal muscle.
  • Sequence similaritiesBelongs to the ORAOV1 family.
  • Information by UniProt

Recombinant Human ORAV1 protein images

  • 15% SDS-PAGE analysis of 3 µg ab124571.

References for Recombinant Human ORAV1 protein (ab124571)

ab124571 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124571.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"