Overview

  • Product name
    Recombinant Human ORC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAHYPTRLTTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIG QFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKR HLLGRKPGAQ
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1 to 110
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • HSORC1
    • MmORC1
    • orc1
    • ORC1_HUMAN
    • ORC1L
    • Origin Recognition Complex 1
    • Origin recognition complex subunit 1
    • Origin recognition complex subunit 1 (yeast homolog) like
    • Origin recognition complex subunit 1 homolog
    • Origin recognition complex subunit 1 like
    • Origin recognition complex subunit 1 like (S. cerevisia
    • Origin recognition complex subunit 1 S. cerevisiae homolog like
    • Origin recognition complex, subunit 1 like (yeast)
    • PARC1
    • Replication control protein 1
    see all
  • Function
    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities
    Belongs to the ORC1 family.
    Contains 1 BAH domain.
  • Developmental stage
    Expression is cell-cycle regulated, it starts to accumulate in mid-G1 phase, reaches a peak at the G1/S boundary, and decreases to a basal level in S phase (at protein level).
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human ORC1 protein images

  • ab112336 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human ORC1 protein (ab112336)

ab112336 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up