Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWSEA FATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQKTD HVARLTWGGC
    • Amino acids
      602 to 711
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161705 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homolog of Latheo
    • homolog of latheo, Drosophila
    • LAT
    • LATHEO
    • LATHEO, drosophila, homolog of
    • orc3
    • ORC3_HUMAN
    • ORC3L
    • Origin recognition complex subunit 3
    • Origin recognition complex subunit 3 honolog
    • Origin Recognition Complex Subunit 3 Isoform 1
    • Origin recognition complex subunit 3 like
    • Origin recognition complex subunit Latheo
    • Origin Recognition Complex, subunit 3, S. cerevisiae, homolog of
    • Origin recognition complex, subunit 3-like (S. cerevisiae)
    • Origin recognition complex, subunit 3-like (yeast)
    see all
  • Function
    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities
    Belongs to the ORC3 family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab161705 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161705 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161705.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up