Recombinant Human Orexin Receptor 2 protein (ab112299)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP KEYE
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 54
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Hcr tr2
    • Hcrt receptor 2
    • Hcrtr2
    • Hypocretin (orexin) receptor 2
    • Hypocretin receptor 2
    • Hypocretin receptor type 2
    • Orexin 2 receptor
    • Orexin A/Orexin B receptor
    • Orexin receptor 2
    • Orexin receptor type 2
    • Orexin type 2 receptor
    • Ox-2-R
    • Ox2-R
    • Ox2r
    • OX2R_HUMAN
    • Type 2 hypocretin receptor
    • Type 2 orexin receptor
    see all
  • Function
    Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides (PubMed:9491897, PubMed:26950369). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:9491897, PubMed:26950369).
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Domain
    The N-terminal region is required for orexin signaling.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab112299 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References

ab112299 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up