Recombinant Human Orexin Receptor 2 protein (ab112299)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHP KEYE
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 54
    • Tags
      GST tag N-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab112299 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    useful for Antibody Production and Protein Array
  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    useful for Antibody Production and Protein Array
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione
    Note: Glutathione is reduced

General Info

  • Alternative names
    • Hcr tr2
    • Hcrt receptor 2
    • Hcrtr2
    • Hypocretin (orexin) receptor 2
    • Hypocretin receptor 2
    • Hypocretin receptor type 2
    • Orexin 2 receptor
    • Orexin A/Orexin B receptor
    • Orexin receptor 2
    • Orexin receptor type 2
    • Orexin type 2 receptor
    • Ox-2-R
    • Ox2-R
    • Ox2r
    • OX2R_HUMAN
    • Type 2 hypocretin receptor
    • Type 2 orexin receptor
    see all
  • Function
    Nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides (PubMed:9491897, PubMed:26950369). Triggers an increase in cytoplasmic Ca(2+) levels in response to orexin-A binding (PubMed:9491897, PubMed:26950369).
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Domain
    The N-terminal region is required for orexin signaling.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Orexin Receptor 2 protein images

  • ab112299 analysed on a 12.5% SDS-PAGE Stained with Coomassie Blue.

References for Recombinant Human Orexin Receptor 2 protein (ab112299)

ab112299 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112299.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up