Recombinant Human Ornithine Carbamoyltransferase protein (ab124552)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP00480
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMNKVQLKGRDLLTLKNFTGEEIKYML WLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGH PCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASI PIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMS AAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGG NVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRK PEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
    • Molecular weight39 kDa
    • Amino acids33 to 354
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    Purified by using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.00
    Constituents: 0.39% MES, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • EC 2.1.3.3
    • MGC129967
    • MGC129968
    • MGC138856
    • OCTD
    • Ornithine carbamoyltransferase mitochondrial
    • Ornithine carbamoyltransferase, mitochondrial
    • Ornithine transcarbamylase
    • Otc
    • OTC_HUMAN
    • OTCase
    see all
  • Tissue specificityMainly expressed in liver and intestinal mucosa.
  • PathwayNitrogen metabolism; urea cycle; L-citrulline from L-ornithine and carbamoyl phosphate: step 1/1.
  • Involvement in diseaseOrnithine carbamoyltransferase deficiency
  • Sequence similaritiesBelongs to the ATCase/OTCase family.
  • Post-translational
    modifications
    Acetylation at Lys-88 negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.
  • Cellular localizationMitochondrion matrix.
  • Information by UniProt

Recombinant Human Ornithine Carbamoyltransferase protein images

  • 15% SDS-PAGE (3 µg loaded)

References for Recombinant Human Ornithine Carbamoyltransferase protein (ab124552)

ab124552 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"