Recombinant Human Ornithine Carbamoyltransferase protein (ab124552)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSHMNKVQLKGRDLLTLKNFTGEEIKYML WLSADLKFRIKQKGEYLPLLQGKSLGMIFEKRSTRTRLSTETGFALLGGH PCFLTTQDIHLGVNESLTDTARVLSSMADAVLARVYKQSDLDTLAKEASI PIINGLSDLYHPIQILADYLTLQEHYSSLKGLTLSWIGDGNNILHSIMMS AAKFGMHLQAATPKGYEPDASVTKLAEQYAKENGTKLLLTNDPLEAAHGG NVLITDTWISMGQEEEKKKRLQAFQGYQVTMKTAKVAASDWTFLHCLPRK PEEVDDEVFYSPRSLVFPEAENRKWTIMAVMVSLLTDYSPQLQKPKF
    • Molecular weight
      39 kDa
    • Amino acids
      33 to 354
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124552 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >95% by SDS-PAGE .
    Purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 6.00
    Constituents: 0.39% MES, 0.03% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • EC 2.1.3.3
    • MGC129967
    • MGC129968
    • MGC138856
    • OCTD
    • Ornithine carbamoyltransferase mitochondrial
    • Ornithine carbamoyltransferase, mitochondrial
    • Ornithine transcarbamylase
    • Otc
    • OTC_HUMAN
    • OTCase
    see all
  • Tissue specificity
    Mainly expressed in liver and intestinal mucosa.
  • Pathway
    Nitrogen metabolism; urea cycle; L-citrulline from L-ornithine and carbamoyl phosphate: step 1/1.
  • Involvement in disease
    Ornithine carbamoyltransferase deficiency
  • Sequence similarities
    Belongs to the ATCase/OTCase family.
  • Post-translational
    modifications
    Acetylation at Lys-88 negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab124552 (3 µg) at approximately 38.9 kDa.

References

ab124552 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124552.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up