Recombinant Human Ornithine Decarboxylase protein (ab113125)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP11926
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMNNFGNEEFDCHFLDEGFTAKDILDQK INEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIV KTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNG VQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTS RLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGF SMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGR YYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFN CILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHV GDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPP EVEEQDASTLPVSCAWESGMKRHRAACASASINV
    • Molecular weight54 kDa including tags
    • Amino acids1 to 461
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.
    ab113125 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • DCOR_HUMAN
    • Dodc1
    • ODC
    • Odc 1
    • Odc1
    • ODC2
    • Ornithine decarboxylase
    • Ornithine decarboxylase 1
    • Ornithine decarboxylase 2
    • Ornithine decarboxylase structural 1
    • RNODC
    see all
  • PathwayAmine and polyamine biosynthesis; putrescine biosynthesis via L-ornithine pathway; putrescine from L-ornithine: step 1/1.
  • Sequence similaritiesBelongs to the Orn/Lys/Arg decarboxylase class-II family.
  • Post-translational
    modifications
    S-Nitrosylation inhibits the enzyme. S-Nitrosylated in vitro on 4 cysteine residues.
  • Information by UniProt

Recombinant Human Ornithine Decarboxylase protein images

  • 15% SDS-PAGE analysis of ab113125 (3 µg).

References for Recombinant Human Ornithine Decarboxylase protein (ab113125)

ab113125 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"