Recombinant Human Ornithine Decarboxylase protein (ab113125)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMNNFGNEEFDCHFLDEGFTAKDILDQK INEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIV KTLAATGTGFDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNG VQMMTFDSEVELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTS RLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGF SMYLLDIGGGFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGR YYVASAFTLAVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFN CILYDHAHVKPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHV GDWMLFENMGAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPP EVEEQDASTLPVSCAWESGMKRHRAACASASINV
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 461
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113125 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 95 % SDS-PAGE.
    ab113125 was purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • DCOR_HUMAN
    • Dodc1
    • ODC
    • Odc 1
    • Odc1
    • ODC2
    • Ornithine decarboxylase
    • Ornithine decarboxylase 1
    • Ornithine decarboxylase 2
    • Ornithine decarboxylase structural 1
    • RNODC
    see all
  • Pathway
    Amine and polyamine biosynthesis; putrescine biosynthesis via L-ornithine pathway; putrescine from L-ornithine: step 1/1.
  • Sequence similarities
    Belongs to the Orn/Lys/Arg decarboxylase class-II family.
  • Post-translational
    modifications
    S-Nitrosylation inhibits the enzyme. S-Nitrosylated in vitro on 4 cysteine residues.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab113125 (3 µg).

References

ab113125 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113125.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up