Recombinant Human Ornithine Decarboxylase protein (ab114536)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP11926
    • SpeciesHuman
    • SequenceMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILK KHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGAGFDCASKTEIQLVQS LGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAK LVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGS GCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDVKLKFEE ITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIVLKEQ TGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHVKPLLQKRPKPDEKY YSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGF QRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDASTLPVSCAWESGMKRH RAACASASINV
    • Molecular weight77 kDa including tags
    • Amino acids1 to 461

Specifications

Our Abpromise guarantee covers the use of ab114536 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 µg/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DCOR_HUMAN
    • Dodc1
    • ODC
    • Odc 1
    • Odc1
    • ODC2
    • Ornithine decarboxylase
    • Ornithine decarboxylase 1
    • Ornithine decarboxylase 2
    • Ornithine decarboxylase structural 1
    • RNODC
    see all
  • PathwayAmine and polyamine biosynthesis; putrescine biosynthesis via L-ornithine pathway; putrescine from L-ornithine: step 1/1.
  • Sequence similaritiesBelongs to the Orn/Lys/Arg decarboxylase class-II family.
  • Post-translational
    modifications
    S-Nitrosylation inhibits the enzyme. S-Nitrosylated in vitro on 4 cysteine residues.
  • Information by UniProt

Recombinant Human Ornithine Decarboxylase protein images

  • 12.5% SDS-PAGE showing ab114536 at approximately 76.82kDa stained with Coomassie Blue.

References for Recombinant Human Ornithine Decarboxylase protein (ab114536)

ab114536 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114536.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"