Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVT FYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESD NEV
    • Amino acids
      244 to 346
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686A11164
    • KIAA1451
    • MGC126578
    • MGC133203
    • MST120
    • MSTP120
    • ORP 8
    • OSBP related protein 8
    • OSBP10
    • OSBPL8
    • Oxysterol binding protein like 8
    • Oxysterol binding protein like protein 8
    • Oxysterol binding protein related protein 8
    see all
  • Relevance
    ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux.
  • Cellular localization
    Endoplasmic reticulum

Images

  • ab153577 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up