Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GATVLPANTPGNVGSGKDQCCSGKGDMSDEDDENEFFDAPEIITMPENLG HKRTGSNISGASSDISLDEQYKHQLEETKKEKRT
    • Molecular weight
      35 kDa including tags
    • Amino acids
      324 to 407

Specifications

Our Abpromise guarantee covers the use of ab152583 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • OSBP
    • OSBP 1
    • OSBP1_HUMAN
    • Oxysterol binding protein 1
    • Oxysterol-binding protein 1
    see all
  • Function
    Binds cholesterol and a range of oxysterols. Cholesterol binding promotes the formation of a complex with PP2A and a tyrosine phosphatase which dephosphorylate ERK1/2, whereas 25-hydroxycholesterol causes its disassembly. Regulates cholesterol efflux by decreasing ABCA1 stability.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the OSBP family.
    Contains 1 PH domain.
  • Domain
    The PH and Ala/Gly-rich domains control cholesterol binding without affecting 25-hydroxycholesterol binding.
    The second coiled-coil domain is required for interaction with the tyrosine phosphatase.
  • Cellular localization
    Cytoplasm. Golgi apparatus membrane. When bound to oxysterols, translocates to the periphery of Golgi membranes.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152583 stained with Coomassie Blue.

References

ab152583 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152583.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up