Recombinant Human OSBPL2 protein (ab160697)

Overview

  • Product name
    Recombinant Human OSBPL2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDV ADDVPVAQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGM
    • Amino acids
      294 to 393
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ20223
    • KIAA0772
    • MGC4307
    • MGC8342
    • ORP2
    • OSBP related protein 2
    • Oxysterol binding protein like 2
    • Oxysterol binding protein related protein 2
    see all
  • Relevance
    This gene encodes a member of the oxysterol binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N terminal pleckstrin homology domain and a highly conserved C terminal OSBP like sterol binding domain, although some members contain only the sterol binding domain. This encoded protein contains only the sterol binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3 phosphate, but cannot bind to 25 hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described.

Images

  • ab160697 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up