Recombinant Human OSBPL5 protein (ab165050)

Overview

  • Product name
    Recombinant Human OSBPL5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EAFLRRRFSLCPPSSTPQKVDPRKLTRNLLLSGDNELYPLSPGKDMEPNG PSLPRDEGPPTPSSATKVPPAEYRLCNGSDKECVSPTARVTKKETL
    • Amino acids
      4 to 99
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp586H1719
    • FLJ31948
    • KIAA1534
    • OBPH1
    • ORP 5
    • ORP5
    • OSBP related protein 5
    • Oxysterol binding protein homolog 1
    • Oxysterol binding protein homologue 1
    • Oxysterol binding protein like 5
    • Oxysterol binding protein related protein 5
    see all
  • Relevance
    OSBPL5 is a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain. Transcript variants encoding different isoforms have been identified.

Images

  • ab165050 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up