Recombinant Human OSBPL9 protein (ab165052)

Overview

  • Product name
    Recombinant Human OSBPL9 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVESIKHCIVLLQIAKSTINPVDAIYQPSPLEPVISTMPSQTVLPPEPVQ LCKSEQRPSSLPVGPVLATLGHHQTPTPNSTGSGHSPPSSSLTSPSHVNL SPNTVPEFSYSSSEDEFYDADEFHQSGSSPKRLIDSSGSASVLTHSSSGN SLKRPDTTESLNSSLSNGTSDADLFDSHDDRDDDAEAGSVEEHKSVIMHL LSQVRLGMDLTKVVLPTFILERRSLLEMYADFFAHPDLFVSISDQKDPKD RMVQVVKWYLSAFHAGRKGSVAKKPYNPILGEIFQCHWTLPNDTEENTEL VSEGPVPWVSKNSVTFVAEQVSHHPPISAFYAECFNKKIQFNAHIWTKSK FLGMSIGVHNIGQGCVSCLDYDEHYILTFPNGYGRSILTVPWVELGGECN INCSKTGYSANIIFHTKPFYGGKKHRITAEIFSPNDKKSFCSIEGEWNGV MYAKYATGENTVFVDTKKLPIIKKKVRKLEDQNEYESRSLWKDVTFNLKI RDIDAATEAKHRLEERQRAEARERKEKEIQWETRLFHEDGECWVYDEPLL KRLGAAKH
    • Amino acids
      1 to 558
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165052 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ12492
    • FLJ14629
    • FLJ14801
    • FLJ32055
    • FLJ34384
    • MGC15035
    • ORP9
    • OSBP related protein 9
    • OSBP4
    • Oxysterol binding protein like 9
    • Oxysterol binding protein related protein 9
    • oxysterol binding protein-like 9
    • oxysterol binding proteinlike9
    see all
  • Relevance
    The OSBPL9 gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although some members contain only the sterol-binding domain. OSBPL9 appears to be in a distinct OSBP subfamily and shares relatively little homology in the sterol-binding domain with other OSBPs. Multiple transcript variants have been identified, most of which encode distinct isoforms.
  • Cellular localization
    Golgi Apparatus.

Images

  • ab165052 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165052 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165052.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up