Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      TLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWEGEGPEARPASSAPG MQAPGPPPSDPGAQAPSLSSFRPRGLVLQP
    • Amino acids
      175 to 254
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165243 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hOSCAR
    • hOSCARM2
    • hOSCARM3
    • mOSCAR
    • Oscar
    • Oscar protein
    • OSCAR_HUMAN
    • OSCARS1
    • OSCARS2
    • Osteoclast associated immunoglobulin like receptor
    • Osteoclast associated receptor
    • Osteoclast-associated immunoglobulin-like receptor
    • Osteoclast-associated receptor
    • PIgR-3
    • PIGR3
    • Poly Ig receptor 3
    • Poly-Ig receptor 3
    • Polymeric immunoglobulin receptor 3
    see all
  • Function
    Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation.
  • Sequence similarities
    Belongs to the leukocyte receptor complex/polymeric immunogobulin receptor (PIR/LRC) family.
    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • ab165243 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165243 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165243.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up