Overview

  • Product name
    Recombinant Human OSR1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAV HLHQWTLGYPAMHLPRSSFSKVPGTVSSLVDARFQLPAFPWFPHVIQPKP
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ODD
    • Odd skipped Drosophila homolog
    • Odd skipped homolog
    • Odd skipped related 1
    • Odd skipped related 1 (Drosophila)
    • Odd skipped related 1 Drosophila
    • Odd1
    • Protein odd skipped related 1
    see all
  • Relevance
    The OSR1 (odd skipped related 1) gene encodes a zinc-finger transcription factor that is expressed in the germ ring mesendoderm and subsequently in the endoderm and intermediate mesoderm, prior to the expression of definitive kidney or blood/vascular markers. Osr1 expression marks a multi-potent population of intermediate mesoderm that undergoes progressive restriction to an Osr1-dependent nephron progenitor compartment within the mammalian kidney. Osr1 expression is regulated by Runx2 and Ikzf1, which are known as master-gene of osteogenesis and hematopoiesis, respectively.
  • Cellular localization
    Nuclear

Images

  • ab165327 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165327 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up