Recombinant Human Osteocrin protein (ab105614)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61366
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMVDVTTTEAFDSGVIDVQSTPTVREEKSAT DLTAKLLLLDELVSLENDVIETKKKRSFSGFGSPLDRLSAGSVDHKGKQR KVVDHPKRRFGIPMDRIGRNRLSNSRG
    • Molecular weight14 kDa including tags
    • Amino acids28 to 133
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105614 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 20% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • Musclin
    • Osteocrin
    • OSTN
    • OSTN_HUMAN
  • FunctionAppears to modulate osteoblastic differentiation. Could also function as an autocrine and paracrine factor linked to glucose metabolism in skeletal muscle.
  • Tissue specificityExpressed in bone.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Osteocrin protein images

  • 15% SDS PAGE analysis of ab105614 (3 µg).

References for Recombinant Human Osteocrin protein (ab105614)

ab105614 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105614.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"