Recombinant human Osteoprotegerin protein (ab157265)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYT DSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKH RSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGL LLTQKGNATHDNICSGNSESTQKCGIDVTLC
    • Molecular weight
      21 kDa
    • Amino acids
      22 to 202

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Binds human and mouse RANKL and TRAIL.

    Inhibits rhsTRAIL-mediated apoptosis at a concentration range of 5-20µg/ml, as well as rhsRANKL-induced osteoclastogenesis and stimulation of dendritic cells. Concentrations of ab157265 required to inhibit may vary depending on the cell type studied and on the concentration of rhsTRAIL used to kill the cells.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Additional notes
    Binds human and mouse RANKL and TRAIL.

    Inhibits rhsTRAIL-mediated apoptosis at a concentration range of 5-20µg/ml, as well as rhsRANKL-induced osteoclastogenesis and stimulation of dendritic cells. Concentrations of ab157265 required to inhibit may vary depending on the cell type studied and on the concentration of rhsTRAIL used to kill the cells.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, prepare aliquots and store at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • MGC29565
    • OCIF
    • OPG
    • Osteoclastogenesis inhibitory factor
    • Osteoprotegerin
    • PDB5
    • TNF receptor superfamily member 11b
    • TNFRSF 11B
    • TNFRSF11B
    • TR 1
    • TR1
    • TR11B_HUMAN
    • Tumor necrosis factor receptor superfamily member 11B
    see all
  • Function
    Acts as decoy receptor for RANKL and thereby neutralizes its function in osteoclastogenesis. Inhibits the activation of osteoclasts and promotes osteoclast apoptosis in vitro. Bone homeostasis seems to depend on the local RANKL/OPG ratio. May also play a role in preventing arterial calcification. May act as decoy receptor for TRAIL and protect against apoptosis. TRAIL binding blocks the inhibition of osteoclastogenesis.
  • Tissue specificity
    Highly expressed in adult lung, heart, kidney, liver, spleen, thymus, prostate, ovary, small intestine, thyroid, lymph node, trachea, adrenal gland, testis, and bone marrow. Detected at very low levels in brain, placenta and skeletal muscle. Highly expressed in fetal kidney, liver and lung.
  • Involvement in disease
    Defects in TNFRSF11B are the cause of juvenile Paget disease (JPD) [MIM:239000]; also known as hyperostosis corticalis deformans juvenilis or hereditary hyperphosphatasia or chronic congenital idiopathic hyperphosphatasia. JPD is a rare autosomal recessive osteopathy that presents in infancy or early childhood. The disorder is characterized by rapidly remodeling woven bone, osteopenia, debilitating fractures, and deformities due to a markedly accelerated rate of bone remodeling throughout the skeleton. Approximately 40 cases of JPD have been reported worldwide. Unless it is treated with drugs that block osteoclast-mediated skeletal resorption, the disease can be fatal.
  • Sequence similarities
    Contains 2 death domains.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    N-glycosylated. Contains sialic acid residues.
    The N-terminus is blocked.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • Inhibition of TRAIL- mediated apoptosis: ab157265 exerts its inhibitory activity in a concentration range of 5-20µg/ml.

References

ab157265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up