Recombinant Human Otoraplin protein (ab119142)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      VHGIFMDRLASKKLCADDECVYTISLASAQEDYNAPDCRFINVKKGQQIY VYSKLVKENGAGEFWAGSVYGDGQDEMGVVGYFPRNLVKEQRVYQEATKE VPTTDIDFFCE
    • Molecular weight
      13 kDa
    • Amino acids
      18 to 128
    • Additional sequence information
      Otoraplin Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 111 amino acids and having a molecular mass of 12.7 kDa.

Specifications

Our Abpromise guarantee covers the use of ab119142 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Purity
    > 95 % SDS-PAGE.
    ab119142 is purified by proprietary chromatographic techniques and is greater than 98.0% pure as determined by analysis by RP-HPLC and by SDS-PAGE.
  • Form
    Lyophilised
  • Additional notes
    Lyophilized ab119142 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution ab119142 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Please see notes section.

    pH: 7.40
    Constituents: 0.19% PBS, 0.75% Sodium chloride

  • Reconstitution
    Reconstitute the lyophilized Otoraplin in 50ul sterile ultra pure.

General Info

  • Alternative names
    • FDP
    • Fibrocyte derived protein
    • Fibrocyte-derived protein
    • Melanoma inhibitory activity like protein
    • Melanoma inhibitory activity-like protein
    • MGC126737
    • MGC126739
    • MIAL
    • MIAL1
    • OTOR
    • OTOR_HUMAN
    • Otoraplin
    • OTTHUMP00000030323
    see all
  • Tissue specificity
    Highly expressed in cochlea.
  • Sequence similarities
    Belongs to the MIA/OTOR family.
    Contains 1 SH3 domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

References for Recombinant Human Otoraplin protein (ab119142)

ab119142 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119142.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up