Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAAEEPQQQKQEPLGSDSEGVNCLAYDEAIMAQQDRIQQEIAVQNPLVSE RLELSVLYKEYAEDDNIYQQKIKDLHKKYSYIRKTRPDGNCFYRAFGFSH LEALLDDSKELQRFKAVSAKSKEDLVSQGFTEFTIEDFHNTFMDLIEQVE KQTSVADLLASFNDQSTSDYLVVYLRLLTSGYLQRESKFFEHFIEGGRTV KEFCQQEVEPMCKESDHIHIIALAQALSVSIQVEYMDRGEGGTTNPHIFP EGSEPKVYLLYRPGHYDILYK
    • Molecular weight
      33 kDa including tags
    • Amino acids
      1 to 271

Specifications

Our Abpromise guarantee covers the use of ab157086 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.02% DTT, 0.79% Tris HCl, 0.29% Sodium chloride

General Info

  • Alternative names
    • Deubiquitinating enzyme OTUB1
    • hOTU1
    • HSPC263
    • OTB1
    • OTU domain containing ubiquitin aldehyde binding protein 1
    • OTU domain, ubiquitin aldehyde binding 1
    • OTU domain-containing Ubal-binding protein 1
    • OTU domain-containing ubiquitin aldehyde-binding protein 1
    • OTU-domain Ubal-binding 1
    • OTU1
    • Otub1
    • OTUB1_HUMAN
    • Otubain 1
    • Otubain-1
    • Ubiquitin specific processing protease OTUB1
    • Ubiquitin thioesterase OTUB1
    • ubiquitin-specific protease otubain 1
    • Ubiquitin-specific-processing protease OTUB1
    see all
  • Function
    Hydrolase that can remove conjugated ubiquitin from proteins and plays an important regulatory role at the level of protein turnover by preventing degradation. Regulator of T-cell anergy, a phenomenon that occurs when T-cells are rendered unresponsive to antigen rechallenge and no longer respond to their cognate antigen. Acts via its interaction with RNF128/GRAIL, a crucial inductor of CD4 T-cell anergy. Isoform 1 destabilizes RNF128, leading to prevent anergy. In contrast, isoform 2 stabilizes RNF128 and promotes anergy. Surprisingly, it regulates RNF128-mediated ubiquitination, but does not deubiquitinate polyubiquitinated RNF128. Deubiquitinates estrogen receptor alpha (ESR1). Mediates deubiquitination of 'Lys-48'-linked polyubiquitin chains, but not 'Lys-63'-linked polyubiquitin chains. Not able to cleave di-ubiquitin. Also capable of removing NEDD8 from NEDD8 conjugates, but with a nuch lower preference compared to 'Lys-48'-linked ubiquitin.
  • Tissue specificity
    Isoform 1 is ubiquitous. Isoform 2 is expressed only in lymphoid tissues such as tonsils, lymph nodes and spleen, as well as peripheral blood mononuclear cells.
  • Sequence similarities
    Belongs to the peptidase C65 family.
    Contains 1 OTU domain.
  • Domain
    In addition to ubiquitin-binding at the Cys-91 active site, a proximal ubiquitin-binding site is also present at Cys-23 Occupancy of the active site is needed to enable tight binding to the second site. Distinct binding sites for the ubiquitins may allow to discriminate among different isopeptide linkages (i.e. 'Lys-48'-, 'Lys-63'-linked polyubiquitin) in polyubiquitin substrates and achieve linkage-specific deubiquitination.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab157086 stained with Coomassie (8µg).
  • Deubiquitinylation assay: Western Blot showing polyubiquitin chains (K48-linked; K63-linked) incubated with (+) or without (-) ab157086 detected with ubiquitin polyclonal antibody at 1/1000 dilution.

References

ab157086 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157086.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up