Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ96DC9
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSETSFNLISEKCDILSILRDHPENRIYRR KIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSREIFKFKERVLQ TPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDH IVQFLRLLTSAFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQI TALSQALSIALQVEYVDEMDTALNHHVFPEAATPSVYLLYKTSHYNILYA ADKH
    • Molecular weight29 kDa including tags
    • Amino acids1 to 234
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab106896 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab106896 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.02% DTT, 10% Glycerol, 0.29% Sodium chloride

General Info

  • Alternative names
    • C14orf137
    • Deubiquitinating enzyme OTUB2
    • FLJ21916
    • MGC3102
    • OTB2
    • OTU domain containing ubiquitin aldehyde binding protein 2
    • OTU domain, ubiquitin aldehyde binding 2
    • OTU domain-containing ubiquitin aldehyde-binding protein 2
    • OTU2
    • Otub2
    • OTUB2_HUMAN
    • Otubain 2
    • Otubain-2
    • Ubiquitin specific processing protease OTUB2
    • Ubiquitin specific protease otubain 2
    • Ubiquitin thioesterase OTUB2
    • Ubiquitin-specific-processing protease OTUB2
    see all
  • FunctionHydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains.
  • Tissue specificityWidely expressed. Expressed at higher level in brain.
  • Sequence similaritiesBelongs to the peptidase C65 family.
    Contains 1 OTU domain.
  • Information by UniProt

Recombinant Human OTUB2 protein images

  • 15% SDS-PAGE showing ab106896 at approximately 29.4kDa (3µg).

References for Recombinant Human OTUB2 protein (ab106896)

ab106896 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab106896.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"