Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAK TRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAK KKSSPVR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      10 to 116

Specifications

Our Abpromise guarantee covers the use of ab114691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ38361
    • Homeobox protein OTX 1
    • Homeobox protein OTX1
    • MGC15736
    • Orthodenticle 1
    • Orthodenticle homeobox 1
    • Orthodenticle homolog 1
    • Orthodenticle1
    • Otx 1
    • otx1
    • OTX1_HUMAN
    see all
  • Function
    Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Embryo.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab114691 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114691 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up