Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      YGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQLDVLEALFAK TRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSGSGTKSRPAK KKSSPVR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      10 to 116

Specifications

Our Abpromise guarantee covers the use of ab114691 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ38361
    • Homeobox protein OTX 1
    • Homeobox protein OTX1
    • MGC15736
    • Orthodenticle 1
    • Orthodenticle homeobox 1
    • Orthodenticle homolog 1
    • Orthodenticle1
    • Otx 1
    • otx1
    • OTX1_HUMAN
    see all
  • Function
    Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    Embryo.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human Otx1 protein images

  • ab114691 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Otx1 protein (ab114691)

ab114691 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114691.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up