Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVI QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      579 to 677

Specifications

Our Abpromise guarantee covers the use of ab116737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CHIT5
    • EGP
    • Estrogen dependent oviduct protein
    • Estrogen-dependent oviduct protein
    • MUC9
    • mucin 9
    • Mucin-9
    • OGP
    • OVGP 9
    • Ovgp1
    • OVGP1_HUMAN
    • Oviduct glycoprotein
    • Oviduct-specific glycoprotein
    • Oviductal glycoprotein
    • Oviductin
    see all
  • Function
    Binds to oocyte zona pellucida in vivo. May play a role in the fertilization process and/or early embryonic development.
  • Tissue specificity
    Oviduct.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle. Secretory granules.
  • Information by UniProt

Recombinant Human OVGP1 protein images

  • 12.5% SDS-PAGE of ab116737 stained with Coomassie Blue.

References for Recombinant Human OVGP1 protein (ab116737)

ab116737 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up