Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RNISVTPEGQTMPLRGENLTSEVGTHPRMGNLGLQMEAENRMMLSSSPVI QLPEQTPLAFDNRFVPIYGNHSSVNSVTPQTSPLSLKKEIPENSAVDEE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      579 to 677

Specifications

Our Abpromise guarantee covers the use of ab116737 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • CHIT5
    • EGP
    • Estrogen dependent oviduct protein
    • Estrogen-dependent oviduct protein
    • MUC9
    • mucin 9
    • Mucin-9
    • OGP
    • OVGP 9
    • Ovgp1
    • OVGP1_HUMAN
    • Oviduct glycoprotein
    • Oviduct-specific glycoprotein
    • Oviductal glycoprotein
    • Oviductin
    see all
  • Function
    Binds to oocyte zona pellucida in vivo. May play a role in the fertilization process and/or early embryonic development.
  • Tissue specificity
    Oviduct.
  • Sequence similarities
    Belongs to the glycosyl hydrolase 18 family.
  • Cellular localization
    Cytoplasmic vesicle > secretory vesicle. Secretory granules.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE of ab116737 stained with Coomassie Blue.

References

ab116737 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116737.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up