Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14753
    • SpeciesHuman
    • SequencePRAFLVKKPCVSTCKRNWSELPDEERGEIYVPVSLGFCPPQPYREPEPSV AEPPSCPLALNMSLRDSSYSMAPGPCVVAQLPSEDMGHLTDPQSRDHGF
    • Molecular weight37 kDa including tags
    • Amino acids2 to 100

Specifications

Our Abpromise guarantee covers the use of ab116733 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • hOvo1
    • Ovo homolog like 1
    • Ovo like 1(Drosophila)
    • Ovo, Drosophila, homolog-like, 1
    • Ovol1
    • OVOL1_HUMAN
    • Putative transcription factor Ovo like 1
    • Putative transcription factor Ovo-like 1
    see all
  • FunctionPutative transcription factor. Involved in hair formation and spermatogenesis. May function in the differentiation and/or maintenance of the urogenital system.
  • Tissue specificityExpressed in fetal kidney, and also in adult pancreas and placenta. Not expressed in intestine, peripheral blood lymphocytes and ovary.
  • Sequence similaritiesContains 4 C2H2-type zinc fingers.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human OVOL1 protein images

  • 12.5% SDS-PAGE of 116733 stained with Coomassie Blue.

References for Recombinant Human OVOL1 protein (ab116733)

ab116733 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116733.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"