Overview

  • Product name
    Recombinant Human OXA1L protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAMGLMCGRRELLRLLQSGRRVHSVAGPSQWLGKPLTTRLLFPVAPCCCR PHYLFLAASGPRSLSTSAISFAEVQVQAPPVVAATPSPTAVPEVASGETA DVVQTAAEQSFAELGLGSYTPVGLIQNLLEFMHVDLGLPWWGAIAACTVF ARCLIFPLIVTGQREAARIHNHLPEIQKFSSRIREAKLAGDHIEYYKASS EMALYQKKHGIKLYKPLILPVTQAPIFISFFIALREMANLPVPSLQTGGL WWFQDLTVSDPIYILPLAVTATMWAVLELGAETGVQSSDLQWMRNVIRMM PLITLPITMHFPTAVFMYWLSSNLFSLVQVSCLRIPAVRTVLKIPQRVVH DLDKLPPREGFLESFKKGWKNAEMTRQLREREQRMRNQLELAARGPLRQT FTHNPLLQPGKDNPPNIPSSSSKPKSKYPWHDTLG
    • Amino acids
      1 to 435
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159039 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • HSA
    • Mitochondrial inner membrane protein OXA1L
    • OXA1
    • OXA1 like protein
    • OXA1-like protein
    • OXA1Hs
    • Oxa1l
    • OXA1L_HUMAN
    • Oxidase (cytochrome c) assembly 1 like
    • Oxidase assembly 1 like protein
    • Oxidase assembly 1-like protein
    see all
  • Function
    Required for the insertion of integral membrane proteins into the mitochondrial inner membrane. Essential for the activity and assembly of cytochrome oxidase. Required for the correct biogenesis of ATP synthase and complex I in mitochondria.
  • Sequence similarities
    Belongs to the OXA1/ALB3/YidC family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab159039 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159039 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159039.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up