Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFER QYLS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      75 to 28

Specifications

Our Abpromise guarantee covers the use of ab116857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 oxoacid CoA transferase 1
    • 3-oxoacid CoA-transferase 1
    • EC 2.8.3.5
    • OTTHUMP00000120012
    • OTTHUMP00000221550
    • OXCT
    • Oxct1
    • SCOT
    • Scot S
    • Scot-S
    • SCOT1_HUMAN
    • Somatic type succinyl CoA:3 oxoacid CoA transferase
    • Somatic-type succinyl-CoA:3-oxoacid CoA-transferase
    • Succinyl CoA:3 ketoacid CoA transferase
    • Succinyl CoA:3 ketoacid coenzyme A transferase 1 mitochondrial
    • Succinyl CoA:3 oxoacid CoA transferase
    • Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
    see all
  • Function
    Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
  • Tissue specificity
    Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts.
  • Pathway
    Ketone metabolism; succinyl-CoA degradation; acetoacetyl-CoA from succinyl-CoA: step 1/1.
  • Involvement in disease
    Succinyl-CoA:3-oxoacid CoA transferase deficiency
  • Sequence similarities
    Belongs to the 3-oxoacid CoA-transferase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Recombinant Human OXCT1 protein images

  • 12.5% SDS-PAGE showing ab116857 at approximately 31.57kDa and stained with Coomassie Blue.

References for Recombinant Human OXCT1 protein (ab116857)

ab116857 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up