Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      DALLKTGVKGLTAVSNNAGVDNFGLGLLLRSKQIKRMVSSYVGENAEFER QYLS
    • Molecular weight
      32 kDa including tags
    • Amino acids
      75 to 28

Specifications

Our Abpromise guarantee covers the use of ab116857 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 oxoacid CoA transferase 1
    • 3-oxoacid CoA-transferase 1
    • EC 2.8.3.5
    • OTTHUMP00000120012
    • OTTHUMP00000221550
    • OXCT
    • Oxct1
    • SCOT
    • Scot S
    • Scot-S
    • SCOT1_HUMAN
    • Somatic type succinyl CoA:3 oxoacid CoA transferase
    • Somatic-type succinyl-CoA:3-oxoacid CoA-transferase
    • Succinyl CoA:3 ketoacid CoA transferase
    • Succinyl CoA:3 ketoacid coenzyme A transferase 1 mitochondrial
    • Succinyl CoA:3 oxoacid CoA transferase
    • Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
    see all
  • Function
    Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
  • Tissue specificity
    Abundant in heart, followed in order by kidney, brain, and muscle, whereas in liver it is undetectable; also detectable in leukocytes and fibroblasts.
  • Pathway
    Ketone metabolism; succinyl-CoA degradation; acetoacetyl-CoA from succinyl-CoA: step 1/1.
  • Involvement in disease
    Succinyl-CoA:3-oxoacid CoA transferase deficiency
  • Sequence similarities
    Belongs to the 3-oxoacid CoA-transferase family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116857 at approximately 31.57kDa and stained with Coomassie Blue.

References

ab116857 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116857.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up