Overview

  • Product name
    Recombinant Human OXCT2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAALRLLASVLGRGVPAGGSGLALSQGCARCFATSPRLRAKFYADPVEMV KDISDGATVMIGGFGLCGIPENLIAALLRTRVKDLQVVSSNVGVEDFGLG LLLAARQVRRIVCSYVGENTLCESQYLAGELELELTPQGTLAERIRAGGA GVPAFYTPTGYGTLVQEGGAPIRYTPDGHLALMSQPREVREFNGDHFLLE RAIRADFALVKGWKADRAGNVVFRRSARNFNVPMCKAADVTAVEVEEIVE VGAFPPEDIHVPNIYVDRVIKGQKYEKRIERLTILKEEDGDAGKEEDART RIIRRAALEFEDGMYANLGIGIPLLASNFISPSMTVHLHSENGILGLGPF PTEDEVDADLINAGKQTVTVLPGGCFFASDDSFAMIRGGHIQLTMLGAMQ VSKYGDLANWMIPGKKVKGMGGAMDLVSSQKTRVVVTMQHCTKDNTPKIM EKCTMPLTGKRCVDRIITEKAVFDVHRKKELTLRELWEGLTVDDIKKSTG CAFAVSPNLRPMQ
    • Amino acids
      1 to 513
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163767 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3 oxoacid CoA transferase 2
    • 3-oxoacid CoA-transferase 2A
    • FKSG25
    • mitochondrial
    • OXCT2
    • SCOT T
    • SCOT-t
    • SCOT2_HUMAN
    • SCOTT
    • Succinyl CoA:3 ketoacid coenzyme A transferase 2, mitochondrial
    • Succinyl-CoA:3-ketoacid coenzyme A transferase 2
    • Testis specific succinyl CoA:3 oxoacid CoA transferase
    • Testis-specific succinyl-CoA:3-oxoacid CoA-transferase
    see all
  • Function
    Key enzyme for ketone body catabolism. Transfers the CoA moiety from succinate to acetoacetate. Formation of the enzyme-CoA intermediate proceeds via an unstable anhydride species formed between the carboxylate groups of the enzyme and substrate.
  • Tissue specificity
    Testis specific.
  • Pathway
    Ketone metabolism; succinyl-CoA degradation; acetoacetyl-CoA from succinyl-CoA: step 1/1.
  • Sequence similarities
    Belongs to the 3-oxoacid CoA-transferase family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab163767 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163767 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163767.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up