Overview

  • Product name
    Recombinant Human OXGR1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPG NAVVISTYIFKMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWI FGDFMCKFIRFSFHFNLYSSILFLTCFSIFRYCVIIHPMSCFSIHKTRCA VVACAVVWIISLVAVIPMTFLITSTNRTNRSACLDLTSSDELNTIKWYNL ILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKARRLTILLLLAF YVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
    • Amino acids
      1 to 337
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162111 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2 oxoglutarate receptor 1
    • 2-oxoglutarate receptor 1
    • aKGR
    • Alpha ketoglutarate receptor 1
    • Alpha-ketoglutarate receptor 1
    • G Protein Coupled Receptor 80
    • G Protein Coupled Receptor 99
    • G-protein coupled receptor 80
    • G-protein coupled receptor 99
    • GPR80
    • GPR99
    • MGC119206
    • MGC119207
    • MGC119208
    • OXGR 1
    • Oxgr1
    • OXGR1_HUMAN
    • Oxoglutarate (alpha ketoglutarate) receptor 1
    • Oxoglutarate receptor 1
    • P2RY15
    • P2Y like GPCR
    • P2Y like nucleotide receptor
    • P2Y purinoceptor 15
    • P2Y-like GPCR
    • P2Y-like nucleotide receptor
    • P2Y15
    see all
  • Function
    Receptor for alpha-ketoglutarate. Seems to act exclusively through a G(q)-mediated pathway.
  • Tissue specificity
    Detected in kidney and, to a lower extend, in placenta. Not detected in brain tissues including the frontal cortex, caudate putamen, thalamus, hypothalamus, hippocampus or pons.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162111 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162111 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162111.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up