Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KAAISQLRSPRVKESISNSELFPTTDPVGTLLQVPEQISAHLPQPAGQIA TQPTQVSLPPTAEPAKTAQALSSGSGSQETKIPISLVLRLRNSKKELNDI
    • Amino acids
      351 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160728 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2210022N24Rik
    • 2810422B09Rik
    • AI462649
    • AW209236
    • KIAA1101
    • mKIAA1101
    • OSR 1
    • OSR1
    • OTTHUMP00000209062
    • Oxidative stress responsive 1
    • Oxidative stress responsive 1 protein
    • Oxidative stress-responsive 1 protein
    • OXSR 1
    • OXSR1
    • OXSR1_HUMAN
    • Serine/threonine protein kinase OSR1
    • Serine/threonine-protein kinase OSR1
    see all
  • Function
    Regulates downstream kinases in response to environmental stress. May also have a function in regulating the actin cytoskeleton.
  • Tissue specificity
    Ubiquitously expressed in all tissue examined.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Images

  • ab160728 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160728 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160728.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up