Overview

  • Product nameRecombinant Human P protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ04671
    • SpeciesHuman
    • SequenceGKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREE HIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRE TV
    • Molecular weight37 kDa including tags
    • Amino acids201 to 300

Specifications

Our Abpromise guarantee covers the use of ab116803 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • BEY
    • BEY1
    • BEY2
    • BOCA
    • D15S12
    • EYCL
    • EYCL2
    • EYCL3
    • eye color 2 (central brown)
    • eye color 3 (brown)
    • hair color 3 (brown)
    • HCL3
    • Melanocyte-specific transporter protein
    • OCA2
    • oculocutaneous albinism II
    • oculocutaneous albinism II (pink-eye dilution homolog, mouse)
    • P
    • P protein
    • P_HUMAN
    • PED
    • Pink eyed dilution protein homolog
    • Pink-eyed dilution protein homolog
    • SHEP1
    • total brown iris pigmentation
    see all
  • FunctionCould be involved in the transport of tyrosine, the precursor to melanin synthesis, within the melanocyte. Regulates the pH of melanosome and the melanosome maturation. One of the components of the mammalian pigmentary system. Seems to regulate the post-translational processing of tyrosinase, which catalyzes the limiting reaction in melanin synthesis. May serve as a key control point at which ethnic skin color variation is determined. Major determinant of brown and/or blue eye color.
  • Involvement in diseaseDefects in OCA2 are the cause of albinism oculocutaneous type 2 (OCA2) [MIM:203200]. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. Although affected infants may appear at birth to have complete absence of melanin pigment, most patients acquire small amounts of pigment with age. Visual anomalies include decreased acuity and nystagmus. The phenotype is highly variable. The hair of affected individuals may turn darker with age, and pigmented nevi or freckles may be seen. African and African American individuals may have yellow hair and blue-gray or hazel irides. One phenotypic variant, 'brown OCA,' has been described in African and African American populations and is characterized by light brown hair and skin color and gray to tan irides.
  • Sequence similaritiesBelongs to the CitM (TC 2.A.11) transporter family.
  • Cellular localizationMelanosome membrane.
  • Information by UniProt

Recombinant Human P protein images

  • 12.5% SDS-PAGE showing ab116803 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human P protein (ab116803)

ab116803 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116803.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"