Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAFSEAALEKKLSELSNSQQSVQTLSLWLIHHRKHSRPIVTVWERELRK AKPNRKLTFLYLANDVIQNSKRKGPEFTKDFAPVIVEAFKHVSSETDESC KKHLGRVLSIWEERSVYENDVLEQLKQALYGDKKPRKRTYEQIKVDENEN CSSLGSPSEPPQTLDLVRALQDLENAASGDAAVHQRIASLPVEVQEVSLL DKITDKESGERLSKMVEDACMLLADYNGRLAAEIDDRKQLTRMLADFLRC QKEALAEKEHKLEILDMGVSSNDVVTISIFFLLKINIKP
    • Amino acids
      1 to 289
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163008 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C77387
    • CDKN2B-related protein
    • Cyclin dependent kinase 2B inhibitor related protein
    • Cyclin dependent kinase inhibitor 2B related protein
    • Cyclin dependent kinase inhibitor 2B related protein (p15INK4B related protein)
    • Cyclin dependent kinase inhibitor related protein
    • Cyclin-dependent kinase inhibitor 2B-related protein
    • FLJ10656
    • HsT3101
    • Hypothetical protein FLJ10656
    • KIAA4077
    • MGC19513
    • MGC29396
    • MGC36325
    • mKIAA4077
    • p15INK4B related protein
    • p15INK4B-related protein
    • Putative uncharacterized protein P15RS
    • Regulation of nuclear pre mRNA domain containing 1A
    • Regulation of nuclear pre-mRNA domain-containing protein 1A
    • RGD1307374
    • RPR1A_HUMAN
    • RPRD1A
    see all
  • Function
    Interacts with phosphorylated C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and participates in dephosphorylation of the CTD. May act as a negative regulator of cyclin-D1 (CCND1) and cyclin-E (CCNE1) in the cell cycle.
  • Sequence similarities
    Belongs to the UPF0400 (RTT103) family.
    Contains 1 CID domain.
  • Information by UniProt

Images

  • ab163008 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163008 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163008.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up