Recombinant Human p16 ARC protein (ab124983)

Overview

  • Product name
    Recombinant Human p16 ARC protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSKNTVSSARFRKVDVDEYDENKFVDEEDG GDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVL KVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHE KALAAGGVGSIVRVLTARKTV
    • Molecular weight
      18 kDa including tags
    • Amino acids
      1 to 151
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.
    ab124983 is purified by proprietary chromatographic techniques and sterile filtered.
  • Form
    Liquid
  • Additional notes
    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Actin related protein 2/3 complex subunit 5
    • Actin related protein 2/3 complex subunit 5 (16 kD)
    • Actin related protein 2/3 complex, subunit 5 16kDa
    • Actin-related protein 2/3 complex subunit 5
    • ARC16
    • Arp2/3 complex 16 kDa subunit
    • Arp2/3 protein complex subunit p16
    • ARPC 5
    • Arpc5
    • ARPC5_HUMAN
    • dJ127C7.3
    • MGC88523
    • p16 Arc
    • p16-ARC
    • RP1 127C7.3
    see all
  • Function
    Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
  • Sequence similarities
    Belongs to the ARPC5 family.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cell projection.
  • Information by UniProt

References for Recombinant Human p16 ARC protein (ab124983)

ab124983 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab124983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up