Recombinant Human p18 INK4c protein (ab119460)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAEPWGNELASAAARGDLEQLTSLLQNNVN VNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARA GFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNV GHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ
    • Molecular weight
      21 kDa including tags
    • Amino acids
      1 to 168
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab119460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab119460 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 10% Glycerol, 1.17% Sodium chloride

General Info

  • Alternative names
    • CDK6 inhibitor p18
    • CDKN 2C
    • CDKN 6
    • Cdkn2c
    • CDKN6
    • CDN2C_HUMAN
    • Cyclin dependent inhibitor
    • Cyclin dependent kinase 4 inhibitor C
    • Cyclin dependent kinase 6 inhibitor
    • Cyclin dependent kinase 6 inhibitor p18
    • Cyclin dependent kinase inhibitor 2C
    • Cyclin dependent kinase inhibitor 2C (p18 inhibits CDK4)
    • Cyclin-dependent kinase 4 inhibitor C
    • Cyclin-dependent kinase 6 inhibitor
    • INK4C
    • OTTHUMP00000046546
    • p18
    • p18 inhibits CDK4
    • p18 INK4c
    • p18 INK6
    • p18-INK4c
    • p18-INK6
    see all
  • Function
    Interacts strongly with CDK6, weakly with CDK4. Inhibits cell growth and proliferation with a correlated dependence on endogenous retinoblastoma protein RB.
  • Tissue specificity
    Highest levels found in skeletal muscle. Also found in pancreas and heart.
  • Sequence similarities
    Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.
    Contains 4 ANK repeats.
  • Information by UniProt

Recombinant Human p18 INK4c protein images

  • 15% SDS-PAGE showing ab119460 at approximately 20.7kDa (3µg).

References for Recombinant Human p18 INK4c protein (ab119460)

ab119460 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab119460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up