Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAG ESFTELAHKGGVIGVIINWDCDLDLPAS
    • Amino acids
      128 to 205
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP receptor
    • MGC129601
    • P2RX 2
    • P2RX2
    • P2RX2_HUMAN
    • P2X purinoceptor 2
    • P2X Receptor subunit 2
    • P2X2
    • P2X2a
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 2
    • Purinergic receptor P2X2 isoform A
    • Purinergic receptor P2X2 isoform B
    • Purinergic receptor P2X2 isoform C
    • Purinergic receptor P2X2 isoform D
    • Purinergic receptor P2X2 isoform H
    • Purinergic receptor P2X2 isoform I
    see all
  • Function
    Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle.
  • Involvement in disease
    Deafness, autosomal dominant, 41
  • Sequence similarities
    Belongs to the P2X receptor family.
  • Cellular localization
    Cell membrane. Localizes to the apical membranes of hair cells in the organ of Corti.
  • Information by UniProt

Images

  • ab153197 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153197 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up