Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP56373
    • SpeciesHuman
    • SequenceHEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIIT KMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVL RTCEIQGWCP
    • Molecular weight38 kDa including tags
    • Amino acids45 to 154

Specifications

Our Abpromise guarantee covers the use of ab114452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP receptor
    • MGC129956
    • P2rx3
    • P2RX3_HUMAN
    • P2X purinoceptor 3
    • P2X receptor subunit 3
    • P2X3
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 3
    • Purinergic receptor P2X3
    • Purinoceptor P2X3
    see all
  • FunctionReceptor for ATP that acts as a ligand-gated ion channel.
  • Sequence similaritiesBelongs to the P2X receptor family.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human P2X3 protein images

  • ab114452 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human P2X3 protein (ab114452)

ab114452 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"