Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGQAGCKGLCLSLFDYKTEKYVIAKNKKVGLLYRLLQASILAYLVVWVFL IKKGYQDVDTSLQSAVITKVKGVAFTNTSDLGQRIWDVADYVIPAQGENV FFVVTNLIVTPNQRQNVCAENEGIPDGACSKDSDCHAGEAVTAGNGVKTG RCLRRENLARGTCEIFAWCPLETSSRPEEPFLKEAEDFTIFIKNHIRFPK FNFSKSNVMDVKDRSFLKSCHFGPKNHYCPIFRLGSVIRWAGSDFQDIAL EGGVIGINIEWNCDLDKAASECHPHYSFSRLDNKLSKSVSSGYNFRFARY YRDAAGVEFRTLMKAYGIRFDVMVNGKGAFFCDLVLIYLIKKREFYRDKK YEEVRGLEDSSQEAEDEASGLGLSEQLTSGPGLLGMPEQQELQEPPEAKR GSSSQKGNGSVCPQLLEPHRST
    • Amino acids
      1 to 422
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159040 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP receptor
    • ATP receptor subunit
    • Ionotropic ATP receptor P2X5
    • LRH 1
    • LRH1
    • Lymphoid restricted histocompatibility antigen 1
    • MGC47755
    • P2rx5
    • P2RX5_HUMAN
    • P2X purinoceptor 5
    • P2X5
    • P2X5R
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 5
    • Purinergic receptor P2X5
    see all
  • Function
    Receptor for ATP that acts as a ligand-gated ion channel.
  • Tissue specificity
    Expressed at high levels in brain and immune system.
  • Sequence similarities
    Belongs to the P2X receptor family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab159040 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159040 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159040.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up