Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ15077
    • SpeciesHuman
    • SequenceMEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQ ICTSRRALTRTAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACR LV
    • Molecular weight37 kDa including tags
    • Amino acids1 to 102

Specifications

Our Abpromise guarantee covers the use of ab114708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • G coupled nucleotide receptor
    • G protein coupled 6
    • MGC15335
    • P2 purinoceptor
    • P2ry6
    • P2RY6_HUMAN
    • P2Y purinoceptor 6
    • P2Y6
    • P2Y6 receptor
    • PP2891
    • Purinergic receptor P2Y6
    • pyrimidinergic receptor P2Y
    • Pyrimidinergic receptor P2Y, G protein coupled, 6
    see all
  • FunctionReceptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system.
  • Sequence similaritiesBelongs to the G-protein coupled receptor 1 family.
  • Cellular localizationCell membrane.
  • Information by UniProt

Recombinant Human P2Y6 protein images

  • 12.5% SDS-PAGE showing ab114708 at approximately 36.85 kDa stained with Coomassie Blue.

References for Recombinant Human P2Y6 protein (ab114708)

ab114708 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"